MG_410_MONOMER – phosphate ABC transporter, ATP-binding protein

Name
WID MG_410_MONOMER View in model
Name phosphate ABC transporter, ATP-binding protein View in model
 
Genetics
Gene MG_410 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MEKNIKALWKNFQLKLEKIKHYRKLYEQQIKEYKKKITGLNNETDANEIS
RIKNEIEILNRLIKIKNTKDNVIKKDFDEKNVFEIRNFNFWYNKNKQVLF
DINLDIKRNKITALIGKSGCGKSTFIRCLNKLNDLNENTRWTGDIYFLGK
NINSGIINDLTLRTSVGMVFQKLTPFNFSIFENIAYGIRAHGIHNKNAIN
EIVRQALISAALWDEVKDNLHRNANTLSGGQQQRLCIARAIALQPDVLLM
DEPTSALDSIATNSIELLIQQLKEKFTIVIVTHSMAQTIRITDETIFFAD
GRVIEQGTTKQIFTKPKQKATNSYISGKN*
50
100
150
200
250
300
330
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2762C1701N474O493S7
Molecular weight (pH 7.5; Da) 37965.36 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
32805
Instability index 30.62
Is stable True
Aliphatic index 97.85
GRAVY (25C, pH 7.0) -0.424
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Function
Complex subunit phosphate ABC transporter
(2) MG_410_MONOMER[c] + (2) MG_411_MONOMER[m] + MG_412_MONOMER[e] ⇒ MG_410_411_412_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_410_411_412_PENTAMER).
 
Metadata
Created 2012-10-01 15:08:02
Last updated 2012-10-01 15:14:48