MG_409_MONOMER – phosphate transport system regulatory protein PhoU, putative

Name
WID MG_409_MONOMER View in model
Name phosphate transport system regulatory protein PhoU, putative View in model
 
Genetics
Gene MG_409 View in model
 
Structure
Sequence
1
51
101
151
201
MENINYQILKRSEKKLLKLFFEYFKHVINAHETLNQLLCEDNLEKRKELI
KTIYEMEDQSNRSEFKLINESIWTISKNSPLASHLRLTITIIMSSRDLER
ICDYANNLTKFIEHYLHLDIKIFNNLVTLHQSALNNLKKTFESLQDKEKP
LTLQFENATKTIIEFEHQYRLVLTKYYETINKNEVTERIFLIDLVASVKH
IERINDYCYNIIKSFLFIKNPEIFN*
50
100
150
200
226
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1943C1231N319O353S6
Molecular weight (pH 7.5; Da) 27051.84 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
20775
Instability index 45.54
Is stable False
Aliphatic index 105.27
GRAVY (25C, pH 7.0) -0.374
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit phosphate transport system regulatory protein PhoU, putative
[c]: (2) MG_409_MONOMERMG_409_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0339].
References
  1. Oganesyan V, Oganesyan N, Adams PD, Jancarik J, Yokota HA, Kim R, Kim SH. Crystal structure of the PhoU-like phosphate uptake regulator from Aquifex aeolicus.. J Bacteriol 187, 4238-44 (2005). WholeCell: PUB_0339, PubMed: 15937186

 
Metadata
Created 2012-10-01 15:08:02
Last updated 2012-10-01 15:14:48