MG_406_MONOMER

Name
WID MG_406_MONOMER View in model
 
Genetics
Gene MG_406 View in model
 
Structure
Sequence
1
51
101
151
LFNWNNRKVAKIITLIIFVAWLFVLILIAVVVLTKGNNLDILFGWMLPLP
FAVLNSLSVLRLASFFASLKNVKKQKAVSFFAFFFTARYLIYLIPVIISF
VVTPSIFNTIATIISTLFFPILNLVLSFVWLPLEYFFINLISKSKRKHVA
TGDSFKRN*
50
100
150
159
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1387C890N202O200S1
Molecular weight (pH 7.5; Da) 18148.78 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
26470
Instability index 28.66
Is stable True
Aliphatic index 139.12
GRAVY (25C, pH 7.0) 1.02
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:08:02
Last updated 2012-10-01 15:14:48