MG_399_MONOMER – ATP synthase F1, beta subunit

Name
WID MG_399_MONOMER View in model
Name ATP synthase F1, beta subunit View in model
Cross references PDB: 1D8S
 
Genetics
Gene MG_399 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
LIKKENLTYGKVHQVIGPVVDVIFSESKQLPRVYDCLSVQLKKSELFLEA
TQLIGDDIVRCIALGPTEGLARNVKVTNYNHPIEVPVGKNVLGRMFNVLG
EPIDGKEPLPKKPKLSIHRNPPAFDEQPNTVDIFETGIKVIDLLTPYVRG
GKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYE
MIQGGVIDKTVLVFGQMNEPPGARMRVALTALTMAEYFRDHDNQNVLLFI
DNIFRFTQAGSEVSALLGRMPSAVGYQPTLAIEMGKLQERIASTKTGSIT
SVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTS
RLLDPSVVGINHYKVALGVQNILQRFAELQDIIAILGIDELSDEDKIIVE
RARRIRNFLSQPFFVAEKFSGIAGKYVSLNDTVQSFKEILEGKHDHLPEQ
AFFYVGTIQEAVEKAKRLNQEFDKTK*
50
100
150
200
250
300
350
400
450
477
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Empirical formula (pH 7.5) H3778C2369N634O694S9
Molecular weight (pH 7.5; Da) 52533.61 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
18130
Instability index 34.21
Is stable True
Aliphatic index 101.95
GRAVY (25C, pH 7.0) -0.0748
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit H(+)-transporting two-sector ATPase
MG_398_MONOMER[c] + (3) MG_399_MONOMER[c] + MG_400_MONOMER[c] + (3) MG_401_MONOMER[c] + MG_402_MONOMER[c] + (2) MG_403_MONOMER[m] + (10) MG_404_MONOMER[m] + MG_405_MONOMER[m] ⇒ MG_398_399_400_401_402_403_404_405_22MER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_398_399_400_401_402_403_404_405_22MER). N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

 
Metadata
Created 2012-10-01 15:08:01
Last updated 2012-10-01 15:14:47