MG_398_MONOMER – ATP synthase F1, epsilon subunit

Name
WID MG_398_MONOMER View in model
Name ATP synthase F1, epsilon subunit View in model
Cross references PDB: 1QO1
 
Genetics
Gene MG_398 View in model
 
Structure
Sequence
1
51
101
MKLLRFLVLSPSGIKLDKTIISAQVKTTEGYIGLNFNRAPLIAAIQSHLC
KIIFADQTKREAIIGAGLMLIKKTEAKIFTENFVFADEVDINETLKRKTE
LERKIHHIKDAKLNVKIEQNLMFELLKLSSKKK*
50
100
134
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1158C690N183O189S4
Molecular weight (pH 7.5; Da) 15169.90 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
1615
Instability index 25.29
Is stable True
Aliphatic index 114.33
GRAVY (25C, pH 7.0) -0.0537
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit H(+)-transporting two-sector ATPase
MG_398_MONOMER[c] + (3) MG_399_MONOMER[c] + MG_400_MONOMER[c] + (3) MG_401_MONOMER[c] + MG_402_MONOMER[c] + (2) MG_403_MONOMER[m] + (10) MG_404_MONOMER[m] + MG_405_MONOMER[m] ⇒ MG_398_399_400_401_402_403_404_405_22MER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_398_399_400_401_402_403_404_405_22MER).
 
Metadata
Created 2012-10-01 15:08:01
Last updated 2012-10-01 15:14:47