MG_397_MONOMER

Name
WID MG_397_MONOMER View in model
 
Genetics
Gene MG_397 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
MLVFLILLPFLLLVIFGAYLLVCLFVRQNNLLLKKTKQLYNNLKLSNFNC
VISPFQLLRNEKQALEQSIKVLKQFQIKFDNEINSAFEQLTVYSKPNNIY
RFIWFNRNIKLLNKNLQHLYTKQQEYINLTKNAIVYFNNSYDCLVFYRQA
FCFLNQFINNFLIEKYDSLFYLNVLNRISLLFKEIENCIQAKDVEKQIAF
LNKLHNILSQTIITANRQYMFDIKLSYLTHHFKVLIQKVKQMELMKNKVI
NSQDLLKLHELINNITIKLKDCTNFLNNLNLMLCERNMDEVQEAISWLFQ
AVSSKEKSINLVVENIDDFRNQIQQYEKKNELLKTTIKAIELVFQNETDV
HDLIIELNENCDLITKNINNLNHQSLAQNQINYEKLFYLMSQTNQALEKL
KNSLTDLLNLAVNKFDDYRFFVYTLDDFRFKFFQIENLISDQDLKVPAKT
LQVINKSKLELDNIFTEANNNYLGTFNLFSEKIDLLQIQLTEVICDVVSL
VNLRLMCKQAFLFANKYRQKSSHIDRSLEQLTKLYNRQNYPDTLEGLINL
LTKIKTNTKQDYLELN*
50
100
150
200
250
300
350
400
450
500
550
567
View in model
Is N‑terminal methionine cleaved
No
View in model
Sequence sequence Type: secretory, Location: N, Length: 21 (nt) View in model
Empirical formula (pH 7.5) H4861C3070N789O865S18
Molecular weight (pH 7.5; Da) 67240.19 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
46520
Instability index 38.66
Is stable True
Aliphatic index 113.10
GRAVY (25C, pH 7.0) -0.166
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization e View in model
 
Metadata
Created 2012-10-01 15:08:01
Last updated 2012-10-01 15:14:47