MG_396_MONOMER – ribose 5-phosphate isomerase B

Name
WID MG_396_MONOMER View in model
Name ribose 5-phosphate isomerase B View in model
Cross references PDB: 1NN4
 
Genetics
Gene MG_396 View in model
 
Structure
Sequence
1
51
101
151
MSFNIFIASDHTGLTLKKIISEHLKTKQFNVVDLGPNYFDANDDYPDFAF
LVADKVKKNSDKDLGILICGTGVGVCMAANKVKGVLAALVVSEKTAALAR
QHDNANVLCLSSRFVTDSENIKIVDDFLKANFEGGRHQRRIDKIIRYEKE
TE*
50
100
150
153
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1200C752N206O226S5
Molecular weight (pH 7.5; Da) 16903.10 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
4845
Instability index 25.61
Is stable True
Aliphatic index 94.31
GRAVY (25C, pH 7.0) -0.169
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit ribose 5-phosphate isomerase B
[c]: (2) MG_396_MONOMERMG_396_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer.
 
Metadata
Created 2012-10-01 15:08:01
Last updated 2012-10-01 15:14:47