MG_394_MONOMER – serine hydroxymethyltransferase

Name
WID MG_394_MONOMER View in model
Name serine hydroxymethyltransferase View in model
Cross references PDB: 1EQB
 
Genetics
Gene MG_394 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MFSKVRLLLNKELQRQRENICLIASENYVSQDILAVTGSVLTNKYAEGYP
SKRFYQGCEVVDESENLAIESCKTLFGAQWANVQPHSGSSANYAVYLALL
KPGDTILGLDLNCGGHLTHGSPVNFSGKQYQAVTYSLDFETETLDYDAIL
QIALEHKPKLIICGFSNYSRTVDFKKFSAIAKQVNAYLLADIAHIAGFIA
AGLHQNPLPFVDVVTSTTHKTLRGPRGGIIMSNNQAIIKKLDSGVFPGCQ
GGPLQHVIAAKYVCFKEALNPKFKQYMQQVKDNALAMANWFLKQGYRVVS
KGTETHLFSLVVGNGKDVALWLQKANIVLNMNTIPFETKSAFSPSGIRLG
TPAMTTRGFKTNDFIFVASLIDKVIKSNGNQKVISQTKTAVLNLLKRFPL
YKGLAY*
50
100
150
200
250
300
350
400
407
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H3206C2028N538O577S13
Molecular weight (pH 7.5; Da) 44773.13 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
41215
Instability index 30.53
Is stable True
Aliphatic index 94.18
GRAVY (25C, pH 7.0) -0.0398
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Function
Complex subunit serine hydroxymethyltransferase
[c]: (4) MG_394_MONOMERMG_394_TETRAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homotetramer. Coenzymes Monomer interacts with PL5P with unknown stoichiometry as coenzyme [96].
 
Metadata
Created 2012-10-01 15:08:01
Last updated 2012-10-01 15:14:47