MG_393_MONOMER – chaperonin, 10 kDa

Name
WID MG_393_MONOMER View in model
Name chaperonin, 10 kDa View in model
Cross references PDB: 1PF9, PDB: 2C7D
 
Genetics
Gene MG_393 View in model
 
Structure
Sequence
1
51
101
MNITPIHDNVLVSLVESNKEEVSKKGIITSLASNDKSDANANKGIVIALG
AGPAYGKTEKPKYAFGVGDIIYFKEYSGISFENEGNKYKIIGFEDVLAFE
KPESGKQRKR*
50
100
111
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H856C541N141O167S1
Molecular weight (pH 7.5; Da) 12039.46 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
7450
Instability index 28.25
Is stable True
Aliphatic index 81.71
GRAVY (25C, pH 7.0) -0.443
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit GroEL-GroES chaperonin complex
[c]: (14) MG_392_MONOMER + (7) MG_393_MONOMERMG_392_393_21MER
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_392_393_21MER).
 
Metadata
Created 2012-10-01 15:08:01
Last updated 2012-10-01 15:14:47