MG_392_MONOMER – chaperonin

Name
WID MG_392_MONOMER View in model
Name chaperonin View in model
Cross references PDB: 2NWC
 
Genetics
Gene MG_392 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
MAKELIFGKDARTRLLQGINKIANAVKVTVGPKGQNVILERKFANPLITN
DGVTIAKEIELSDPVENIGAKVISVAAVSTNDIAGDGTTTATILAQEMTN
RGIEIINKGANPVNIRRGIEDASLLIIKELEKYSKKINTNEEIEQVAAIS
SGSKEIGKLIAQAMALVGKNGVITTDDAKTINTTLETTEGIEFKGTYASP
YMVSDQEKMEVVLEQPKILVSSLKINTIKEILPLLEGSVENGNPLLIVAP
DFAEEVVTTLAVNKLRGTINVVAVKCNEYGERQKAALEDLAISSGTLAYN
NEINSGFKDVTVDNLGDARKVQIAKEKTTVIGGKGNKDKIKKHVELLNGR
LKQTTDKYDSDLIKERIAYLSQGVAVIRVGGATELAQKELKLRIEDALNS
TKAAVEEGIIAGGGVGLLNASCVLTNSKLKERYENETSVENIKEILLGFE
IVQKSLEAPARQIIQNSGVDPVKILSELKNEKTGVGFDAETKKKVDMIAN
GIIDPTKVTKTALEKAASVASSLITTNVAVYDVKERKDNSFSE*
50
100
150
200
250
300
350
400
450
500
544
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Empirical formula (pH 7.5) H4294C2569N700O825S8
Molecular weight (pH 7.5; Da) 58444.13 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
13660
Instability index 27.19
Is stable True
Aliphatic index 105.75
GRAVY (25C, pH 7.0) -0.169
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit GroEL-GroES chaperonin complex
[c]: (14) MG_392_MONOMER + (7) MG_393_MONOMERMG_392_393_21MER
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_392_393_21MER). Stable modifications Phosphorylation observed by mass-spec [PUB_0094]. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  2. Su HC, Hutchison CA 3rd, Giddings MC. Mapping phosphoproteins in Mycoplasma genitalium and Mycoplasma pneumoniae. BMC Microbiol 7, 63 (2007). WholeCell: PUB_0094, PubMed: 17605819

 
Metadata
Created 2012-10-01 15:08:01
Last updated 2012-10-01 15:14:47