MG_391_MONOMER – cytosol aminopeptidase

Name
WID MG_391_MONOMER View in model
Name cytosol aminopeptidase View in model
Cross references PDB: 1GYT
 
Genetics
Gene MG_391 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MRINKPFSDDSNTVVFVSSKTYGVKEEAAHNPNVEFGVVLPTDFPAFNRA
LVQFLKRKKTKLNINLDSLIELYKKNENSGCFHTAIKTVITSVTFCETTP
FTMKTKPEKNVEVAVQCAVEYHNLVKEYETVGEYVNLARELQDTPSDLLY
SEVFVKHFEKAASKLPVKIKVLKQSDLIKKKMGLLLGVNQGSEREARLLV
ISYQANKNSKEKLAFVGKGITYDSGGMNIKTGDYMRGMKYDMSGAAIVCS
TVLALAKNKVKTNVVAVAALTENLPGAKAQRPDDIKIAYNGKSVEIDNTD
AEGRLVLADAITYAAKDLAATHIIDVATLTGLMSYILSTTYTGIFSTCDH
QWESFKKAACSAGEPVWRLPMHPDYLKPLQLTKLADLQNSTSARGAGSSR
AACFLAEFREGVSLIHCDIASTASIENLGQGVLVRTLYERASQLANK*
50
100
150
200
250
300
350
400
448
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H3519C2187N587O659S17
Molecular weight (pH 7.5; Da) 49124.84 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
35840
Instability index 33.17
Is stable True
Aliphatic index 90.36
GRAVY (25C, pH 7.0) -0.157
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER, MG_392_393_21MER View in model
 
Function
Complex subunit cytosol aminopeptidase
[c]: (6) MG_391_MONOMERMG_391_HEXAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homohexamer [PUB_0006]. Coenzymes Interacts with 2 MN per monomer as prosthetic group [96].
References
  1. Keseler IM, Bonavides-Martínez C, Collado-Vides J, Gama-Castro S, Gunsalus RP, Johnson DA, Krummenacker M, Nolan LM, Paley S, Paulsen IT, Peralta-Gil M, Santos-Zavaleta A, Shearer AG, Karp PD. EcoCyc: a comprehensive view of Escherichia coli biology. Nucleic Acids Res 37, D464-70 (2009). WholeCell: PUB_0006, PubMed: 18974181

 
Metadata
Created 2012-10-01 15:08:01
Last updated 2012-10-01 15:14:47