MG_390_MONOMER – toxin ABC transporter, ATP-binding/permease protein

Name
WID MG_390_MONOMER View in model
Name toxin ABC transporter, ATP-binding/permease protein View in model
 
Genetics
Gene MG_390 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
MKIIYQEQQNECGICVIGMLANAIHDEKYVHDELLEQINLPPNGLSLFEM
ESYGKKFGLEINSYQLTFQELKELDSKFIIVHFKDHFVIVKNKHENSWEV
YDPAKGKYLLTDEKLEKLWTGYAATVAKAFKEIPPVNKSNFFSNFFDFNL
VTFYVFIELIIIGISTLLATASRTIITNTVDFGTAVNLVVLVVYFSCLKG
LNLLLQVILQLIRNFLFWKQYRGYLGWIIQSLQQKSFVYFSNKSPNQLIE
RQFYLKEVLSFFNFYIPNLIISCVVALIIGVLIGINQLEFLLIAIAQIVV
NAGLFCYDFFFTKKITKKEIPYVELQNKISLQLDENLREEQNKKRFNFLM
LNFRKALLQNQNINNQKEINRLTIENIKSFFQQGFDFAILGLGVIGIIEQ
RYQLSFLFYVFGIQSLFSTYATRIVQFGAAINIYHYCREKLVNLFIETKK
DEGIKVNWQCPDEISLENLSVTLNQHVDLANLSLKIKNETVIFGQNGSGK
STFLKILTGRGFEYTGNIKFNNVDLKRCSKEQLFENVYYLKGQNLMQTEA
NDFGFSEALFNNQNPHIYQLLFDAGVQNQTKLSSGQKQILQLFLLSNIKN
KVILLDECMNAIAPEIKNRVYQLLVKPLTLNNFVVLVEHDLSFASEAQNK
INLTNYLRNS*
50
100
150
200
250
300
350
400
450
500
550
600
650
661
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H5491C3536N881O973S15
Molecular weight (pH 7.5; Da) 76392.51 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
68855
Instability index 33.18
Is stable True
Aliphatic index 109.83
GRAVY (25C, pH 7.0) 0.0508
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit toxin ABC transporter, ATP-binding/permease protein
[m]: (2) MG_390_MONOMERMG_390_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer.
 
Metadata
Created 2012-10-01 15:08:01
Last updated 2012-10-01 15:14:47