MG_388_MONOMER – Putative metalloprotease

Name
WID MG_388_MONOMER View in model
Name Putative metalloprotease View in model
 
Genetics
Gene MG_388 View in model
 
Structure
Sequence
1
51
101
151
LKSSFSINSSRLFKRFFGKNYQAGVELCFQIIKSSLNLSFDPEFALLIVS
CSKMKKLNKQFLKRRGCTDVISLCYNETETGFSLAIGEIFLCPKYIFKKA
KEIGCNNWFLLTRCLIHGILHLFEFNHEESEAFESVTMFFQDAIHEEILS
VWKF*
50
100
150
155
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H1268C828N205O222S9
Molecular weight (pH 7.5; Da) 17934.70 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
16345
Instability index 45.01
Is stable False
Aliphatic index 91.23
GRAVY (25C, pH 7.0) 0.0987
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Comments
Comments Coenzymes Interacts with 1 ZN per monomer as prosthetic group [96].
 
Metadata
Created 2012-10-01 15:08:01
Last updated 2012-10-01 15:14:47