MG_387_MONOMER – GTP-binding protein Era

Name
WID MG_387_MONOMER View in model
Name GTP-binding protein Era View in model
Cross references PDB: 1EGA, PDB: 1X1L
 
Genetics
Gene MG_387 View in model
 
Structure
Sequence
1
51
101
151
201
251
MKVLKVGVLGPTNAGKSTLINFLHNDDSLMVSSMNNTTLLSISTEVINQA
NKNIVFIDVPGFTEKKHSNYELITKEIRKALSGIDVLLLVVRSDQNNKIE
FLKTQLQQLKRYQNLTRIFLINKFHQKSLSEVNKAIILEEFKPQKTIEIN
LLKFDKNLFWSIFKQVELRYNIFRKDINFIDANNDDFKILEGLREQIIFY
CKNEIPHIARIEIIEKSFNKEKNLLKIHLVISVPKLSQKKIIIGKNAEMI
KAIGIATRKKLLNHFDCDIFIDIFVKTEKQKLPVYSFLSK*
50
100
150
200
250
291
View in model
Is N‑terminal methionine cleaved
No
View in model
DNA footprint Length: 19 (nt), Binding: dsDNA, Region: dsDNA View in model
Empirical formula (pH 7.5) H2523C1546N404O424S6
Molecular weight (pH 7.5; Da) 33746.32 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
13200
Instability index 36.80
Is stable True
Aliphatic index 114.19
GRAVY (25C, pH 7.0) -0.133
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
 
Parameters
Parameters Parameter_0042: gtpCost = 1 GTP View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0318]. DNA-binding B. subtilis homolog YlqF has 19 nt RNA footprint [PUB_0738].
References
  1. Chen X, Court DL, Ji X. Crystal structure of ERA: a GTPase-dependent cell cycle regulator containing an RNA binding motif. Proc Natl Acad Sci U S A 96, 8396-401 (1999). WholeCell: PUB_0318, PubMed: 10411886

  2. Matsuo Y, Morimoto T, Kuwano M, Loh PC, Oshima T, Ogasawara N. The GTP-binding protein YlqF participates in the late step of 50 S ribosomal subunit assembly in Bacillus subtilis. J Biol Chem 281, 8110-7 (2006). WholeCell: PUB_0738, PubMed: 16431913

 
Metadata
Created 2012-10-01 15:08:01
Last updated 2012-10-01 15:14:47