MG_386_MONOMER – P200 protein

Name
WID MG_386_MONOMER View in model
Name P200 protein View in model
 
Genetics
Gene MG_386 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
851
901
951
1001
1051
1101
1151
1201
1251
1301
1351
1401
1451
1501
1551
1601
MPKTTKNKNKNTTPKSKTKKYLESANKKSVTKPKKEQDKVENLFDQPFLG
EIKKNILKKTKSFNSKKKETVKSKSKSPIDFFDETKRGVFIVPPETDILS
RRELNQKTVVNTVPNQTSSYPTINENKLVELNNQPETKVLETKKDSFTTT
IREKKLNPEDSQAFWYIFVGDRKYGFWKNHTWVWLGYFDQLQRWNYFKVI
ETVEVPQEHAAFIKQRPADIDFWRPLVGNPNYGFVQNNTWIWKGFFDKKL
NWIPDPVRFTEEALGHTDSLVDEIEKKTISEQPYWEQENDIVVTVFNTKS
LASSLENELLLENSSEEQPVIEEVKPRRNEVIFRNPVTKLHFEKEKFEFL
NPVKETNETIPLIEIVKEEVKVESEVEAPVEIEPEAACEPETTIPEVETV
FVYEDDLKGLDSNQTQAGNVPEVETVFVYEDDLKGLDSIIKDDQQHDEIA
KHVEHLSQDYSKEIKDSAKADLSNISDDIDSVWKEFGSFTDETQKSVEEK
SQVDEIILDANNDFINESLFRDEVVNNIDSQINETVSEQQFEPTYSVNEF
QQEFSEPVVSDEKIKETNSDESVNTDLTALFSEKLVNEVLLTNEYVDVNA
PFSTETEVKVSSELPKSELVDEITFINNDPKPQEGLEYKVDFLETEPKSL
FDEKTTIVVESEPPFIQPDLSLELDSVNDVDKSLETKTTSVELNHEEIGN
EFINLDVSEKEVQEQPTTQLETDSEFVLPTYQIVEDSFTESAETPNEFSS
EQKDTLEFISQTQEVETSESNVPTVEQETKLFEHQDENNLFTPLPLDLTE
IIESNALFDSKPDEKESSDSELQPTFKEIKLDSTVEVPQESSQVEATFDT
VQPEAVFDEIKTQELQPEATTEVVFDDHFQPDVQPEQTPQEAKFDSPVEI
PQESSQAEFHAEQISDEIKLEEKTEAVFDHQQLENQSEETVVTPTEVTAF
EPETIETQLEPSSEDQPSEPALDQNHPEIVTAEVEQIFDGTKLEDLKLEE
ANFDNVENNEVQPKETEAEITFDETKELQQETSSEPLSTEELKSEATFDN
VSEAESEAVFEKPQLETQTEKILEEEPKSEPVDQLITEASFDTVKHEAVF
DKNQTQTEGLEEPQVSSEAEVVDQTTTDTVGEPEAVFDVQPEKTTEVKFD
DVENQQKVISEPQVEQQPGEAVFEPSAEAKFDSPVESVQDSQPEPVLEEV
QTQPEIQPVESQPEATFDTVQPEQTPQEAKFDSPVETVEQPEFSSEPTQQ
HVESEASFDEPNYDFDEPNYDFDQPSYDSDLQPSEPQYDVDEPNYDFDEP
NYEIESKPSEPQFEPQVEQQPGEAVFEPSAEAKFDSPVESVQDSQPEPLL
EEVQTQPEIQPVESQPEATFDTVQPEQTPQEAKFDSPVETIQEPQVSSEP
EVVVQPNFEERKPETVLEEPQADEIQPEASEEESLDWELLVGNNSYGHYE
PDGEWVWAGFFGDDQKWNKDATVKWARERDYLPLIGDEVYGRYNNKGEWI
WYGFYDESGDWVLVDEQWKNRQPRINEAPKFWEKLIGNEEYGYYEDNEWN
WYDGEFDSEGNWLVFQSEETENLNEDITKDIPALEGYDIDSIDADEWLSQ
FSADDAKDVFGSNDKK*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
900
950
1000
1050
1100
1150
1200
1250
1300
1350
1400
1450
1500
1550
1600
1617
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H12207C8226N2037O2858S2
Molecular weight (pH 7.5; Da) 185425.52 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
186795
Instability index 57.83
Is stable False
Aliphatic index 66.27
GRAVY (25C, pH 7.0) -0.917
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization tc View in model
 
Comments
Comments Pich et al implicated MG_386 gene product in gliding motility, but not in cytadherence [PUB_0813].
References
  1. Pich OQ, Burgos R, Ferrer-Navarro M, Querol E, Piñol J. Mycoplasma genitalium mg200 and mg386 genes are involved in gliding motility but not in cytadherence. Mol Microbiol 60, 1509-19 (2006). WholeCell: PUB_0813, PubMed: 16796684

 
Metadata
Created 2012-10-01 15:08:01
Last updated 2012-10-01 15:14:47