MG_385_MONOMER – glycerophosphoryl diester phosphodiesterase family protein

Name
WID MG_385_MONOMER View in model
Name glycerophosphoryl diester phosphodiesterase family protein View in model
 
Genetics
Gene MG_385 View in model
 
Structure
Sequence
1
51
101
151
201
MRKQFLIAYRGYSSIAPENTKLAFQAAQVFDFDGIWIDIQLTKDKQIVVT
HKENFKVSNKNLNLNQINLVDLKKVNLASEFKLKVTSQQIQTLKEVLTQF
IQPFKYLLIHIKDDKENNNSLLEQLNLLCKDFVLAKEKMILLSSNFHIIK
LINETFKGFKTGFVIANKKALLVASRDELMRYCRFLVPNESFYHKNCKEI
QNLGLPVILWVIKGLLRYQFYENDRFVKFQITAQIY*
50
100
150
200
237
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2041C1283N329O343S6
Molecular weight (pH 7.5; Da) 27755.24 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
23295
Instability index 23.27
Is stable True
Aliphatic index 108.57
GRAVY (25C, pH 7.0) -0.108
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit glycerophosphoryl diester phosphodiesterase family protein
[c]: (2) MG_385_MONOMERMG_385_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0375].
References
  1. Jackson CJ, Carr PD, Kim HK, Liu JW, Ollis DL. The purification, crystallization and preliminary diffraction of a glycerophosphodiesterase from Enterobacter aerogenes. Acta Crystallogr Sect F Struct Biol Cryst Commun 62, 659-61 (2006). WholeCell: PUB_0375, PubMed: 16820687

 
Metadata
Created 2012-10-01 15:08:01
Last updated 2012-10-01 15:14:46