MG_384_MONOMER – GTPase1 Obg

Name
WID MG_384_MONOMER View in model
Name GTPase1 Obg View in model
 
Genetics
Gene MG_384 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MAITDYCECRFTAGNGGNGIIAWKREAHYDKGGPGGGNGGNGGNVILQAD
HNCDSLFFLKNKKHLFAEDGQNGKPDLAHGKNGSDLLIKVPIGTTVKNLE
NNSVLVDFVHDKQSFILCFGGKGGKGNAAFKSPIMRAPNLYENGDKGEIL
NVSLEVKYLANVGIVGFPNSGKSTLISKLSNAKPKIANYRFTTLIPVLGV
VKYQNNSLVFADIPGLIENASEGSGLGHDFLRHIERCEILIHLISLDPVD
NDDPCKAYLQIMDELSKYSPLLVKKKMLVVANKIDVNEGEKRFKKLEKFL
QKKSISVLKISALKKELGNLLDRVFELYNKTISQFGANKFSLPMELEKHY
VFQNTNENNNDPLNIEKDSLNRWIVNCKRLRYWFDKIPQTTLDNIRRLGN
KIKEIGIEDQLKSVGAKKGDIIFFDGCEFVIND*
50
100
150
200
250
300
350
400
434
View in model
Is N‑terminal methionine cleaved
No
View in model
DNA footprint Length: 19 (nt), Binding: dsDNA, Region: dsDNA View in model
Empirical formula (pH 7.5) H3439C2161N589O631S13
Molecular weight (pH 7.5; Da) 48183.70 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
33890
Instability index 31.22
Is stable True
Aliphatic index 93.20
GRAVY (25C, pH 7.0) -0.331
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
 
Parameters
Parameters Parameter_0042: gtpCost = 1 GTP View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0319]. DNA-binding B. subtilis homolog YlqF has 19 nt RNA footprint [PUB_0738].
References
  1. Kukimoto-Niino M, Murayama K, Inoue M, Terada T, Tame JR, Kuramitsu S, Shirouzu M, Yokoyama S. Crystal structure of the GTP-binding protein Obg from Thermus thermophilus HB8. J Mol Biol 337, 761-70 (2004). WholeCell: PUB_0319, PubMed: 15019792

  2. Matsuo Y, Morimoto T, Kuwano M, Loh PC, Oshima T, Ogasawara N. The GTP-binding protein YlqF participates in the late step of 50 S ribosomal subunit assembly in Bacillus subtilis. J Biol Chem 281, 8110-7 (2006). WholeCell: PUB_0738, PubMed: 16431913

 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:46