MG_383_MONOMER – NH(3)-dependent NAD+ synthetase, putative

Name
WID MG_383_MONOMER View in model
Name NH(3)-dependent NAD+ synthetase, putative View in model
Cross references PDB: 1WXI
 
Genetics
Gene MG_383 View in model
 
Structure
Sequence
1
51
101
151
201
MTNLIKYLKELQNWLFDYVKKSKAKGVIFGLSGGIDSAVVAAIAKETFGF
ENHLALIMHINNSKLDFQATSELVKKMQFNSINIELEESFNLLVKTLGID
PKKDFLTAGNIKARLRMITLYAYAQKHNFLVLGTGNFVEYTLGYFTKWGD
GACDIAPLAWLLKEDVYKLAKHFNIPEIVITRAPTASLFEGQTDETEMGI
TYKELDQYLKGDLILSSEKQKIVLDLKAKAEHKHNSPLKFKHLYNFQN*
50
100
150
200
249
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H2032C1299N325O363S6
Molecular weight (pH 7.5; Da) 28202.30 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
31525
Instability index 32.29
Is stable True
Aliphatic index 98.76
GRAVY (25C, pH 7.0) -0.140
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit NH(3)-dependent NAD+ synthetase, putative
[c]: (2) MG_383_MONOMERMG_383_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer. Coenzymes Interacts with 2 MG per monomer as prosthetic group [387].
 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:46