MG_382_MONOMER – uridine kinase

Name
WID MG_382_MONOMER View in model
Name uridine kinase View in model
 
Genetics
Gene MG_382 View in model
 
Structure
Sequence
1
51
101
151
201
MDEKGILVAISGGSCSGKTTVAEMIYQLLSKKLKVAIICQDNYYKSYKNK
PLLKRKTINFDHPDAFDWKLLRSHIEDLLNGSIVNVPLYDYINYTRAKKT
AKIGPIDVVILEGLMPWFDEKLSRLSKLKIFIETNGEERLIRRIERDWQR
GRNIDSIIKQWREIVAPMYEIFVEKMKRNADLILPWSQRREVSTSVLDVA
IEHLFHKTVEKNN*
50
100
150
200
214
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H1818C1129N306O315S7
Molecular weight (pH 7.5; Da) 24942.76 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
39670
Instability index 48.25
Is stable False
Aliphatic index 102.01
GRAVY (25C, pH 7.0) -0.355
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit uridine kinase
[c]: (4) MG_382_MONOMERMG_382_TETRAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homotetramer. Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group.
 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:46