MG_380_MONOMER – methyltransferase GidB

Name
WID MG_380_MONOMER View in model
Name methyltransferase GidB View in model
Cross references PDB: 1JSX
 
Genetics
Gene MG_380 View in model
 
Structure
Sequence
1
51
101
151
MNNANFEKYVDLVFEANKNFNLTGFKTKEAIYQNLVIEILTLFKGYEKFF
IDKTVADLGSGNGSPGIILKLLFQKIKKLVLIDSKHKKISFLNKLTKQLN
LEKTVAICERIEVHKNHYDVICSRGLSTIIKVNDLAFSLLNSKGIIFHIK
QSLDQYIEFEKSNQKNQFNLLFIKHFTSQNKKLILIALQKND*
50
100
150
193
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1647C1023N262O280S3
Molecular weight (pH 7.5; Da) 22192.74 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
7700
Instability index 27.48
Is stable True
Aliphatic index 110.10
GRAVY (25C, pH 7.0) -0.128
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme 16S rRNA (guanine-N(2)-)-methyltransferase
[c]: AMET + GMPAHCYS + H + m2GMP
View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0323].
References
  1. Romanowski MJ, Bonanno JB, Burley SK. Crystal structure of the Escherichia coli glucose-inhibited division protein B (GidB) reveals a methyltransferase fold. Proteins 47, 563-7 (2002). WholeCell: PUB_0323, PubMed: 12001236

 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:46