MG_379_MONOMER – tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA

Name
WID MG_379_MONOMER View in model
Name tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA View in model
Cross references PDB: 3CP2
 
Genetics
Gene MG_379 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
MSFIITVIGAGHAGLEAAFIVSKFNIKVNLLVLDINHLGSCPCNPSIGGP
AKGIVTREIDVLGGMQAIAADNNALQYKLLNSSKGPAVQAIRAQIDKIGY
KNWFQSQVKLNKNINLIQSEAINLIVRNEKIKGVILKDGSELLSDAVIIT
TGTYLRSKTYCGNTVKNQGPDQSKNSEKLSTNLINRGFKTIRLKTGTPPR
ILKTSLDYNQMELEINNNQNLAFSTTNKNFLPLEKQIPCYLVHTNQKIHD
LILKNLKKSAMFNGSISAQGPLYCPSIEDKVFKFSQKPRHQIFVEPESLS
LDTIYLAGLSTSFTPEIQKEIIQLLPGFQNAEIKKFGYAIEYDAFLSNQL
KPTLETKLIENLYFAGQINGTSGYEEAAGQGLMAGINAALKLLKKPPFIL
QRNEAYIGVMINDLVTKTISDPYRLLTSRAEYRLWLRNDNVQERLIKKSF
ELGLTDKKTYELFLKKEKKKQELISFLKNTQVGKVKALKFTNKNTAQSLY
DFNKRSEINLDKLIKDLPEKYQLDSETLKQIEIEIKYEGYIKKNEKYFKG
LDKLSKIKIPHTFDYHKVKNLASEAIFKLSNFKPSNLAIASQIAGVNFND
IIAIKHFLKTYE*
50
100
150
200
250
300
350
400
450
500
550
600
613
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H5057C3131N823O903S11
Molecular weight (pH 7.5; Da) 69030.14 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
45895
Instability index 26.30
Is stable True
Aliphatic index 99.79
GRAVY (25C, pH 7.0) -0.292
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Function
Complex subunit tRNA uridine 5-carboxymethylaminomethyl modification enzyme
[c]: (2) MG_008_MONOMER + (2) MG_379_MONOMERMG_008_379_TETRAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer. Coenzymes Monomer interacts with FAD with unknown stoichiometry as coenzyme [96].
 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:46