MG_378_MONOMER – arginyl-tRNA synthetase

Name
WID MG_378_MONOMER View in model
Name arginyl-tRNA synthetase View in model
 
Genetics
Gene MG_378 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
MFFIINDLKECISALKLKFDDQKELVKLVKNNSFNGFSSTIIFQLKSENH
KKIADSIVEWFLKNKKDNYQNVFIANNNFINFQISYQKYLEYLIKTPCFT
KKNIKILIESVSANPTGRIHLGHVRIAFFGDVLNNLAKLLGYTTVCEYWV
NDYGQQARVFSFSVYQSLQLKKNIAIQQHPDGYSGIVIDKIASEIENFPV
DNLNFEEFCKTSFLDHFLVNCTQKVLSLIKSDLNKIHVFIDSWKFESEIV
KKTNFNDLLEQLKPNSYFYQDNALWLKTTLYGDDKDRVLIRSDKRASYFG
TDVAYHLEKLQRGFDILFNVWGTDHEGHIKRMYCAFDALKNTTKTSLKIF
ALQLVTLYKNKELVRLSKRAGNVITIETMLSMISEDAARWFMLSQNNGTI
IKIDLDIANLQNSANPVYYVQYAFARMNSILRIANSDQLKEITDCSLLIN
EKEISLLNQLVYYPFMLQKAMETGELHLLTNFLYETASLFHSWYKVCKIN
DDKNSLLSAQRLALLRSLQFIVKQILDVLKISTPQQM*
50
100
150
200
250
300
350
400
450
500
538
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H4456C2853N730O806S17
Molecular weight (pH 7.5; Da) 62423.24 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
73770
Instability index 28.36
Is stable True
Aliphatic index 101.12
GRAVY (25C, pH 7.0) -0.146
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0365]. Coenzymes Interacts with 1 MG per monomer as prosthetic group [387].
References
  1. Charlier J, Gerlo E. Arginyl-tRNA synthetase from Escherichia coli K12. Purification, properties, and sequence of substrate addition. Biochemistry 18, 3171-8 (1979). WholeCell: PUB_0365, PubMed: 37899

 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:46