MG_377_MONOMER

Name
WID MG_377_MONOMER View in model
 
Genetics
Gene MG_377 View in model
 
Structure
Sequence
1
51
101
151
MATNLKSIAKLQKPIQYDKVIEVDRIFADPAFIEQHRQRILASFKDAKES
ALYHELTHIVIKDNLFSAAMNEIVSYFEFQINPEELKNVVEGLKRDVVKD
ADEKTIQSIAEKIIKKALVFNFLQKEWKVEVSDDIVKRVISLYYEKTNQN
VREYLDDKQKFEGIRTALIEERMVLETINHFKFHFNLTGQLPS*
50
100
150
194
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1629C1031N269O298S3
Molecular weight (pH 7.5; Da) 22656.72 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
14440
Instability index 27.73
Is stable True
Aliphatic index 99.48
GRAVY (25C, pH 7.0) -0.355
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Comments
Comments Stable modifications Phosphorylation observed by mass-spec [PUB_0094].
References
  1. Su HC, Hutchison CA 3rd, Giddings MC. Mapping phosphoproteins in Mycoplasma genitalium and Mycoplasma pneumoniae. BMC Microbiol 7, 63 (2007). WholeCell: PUB_0094, PubMed: 17605819

 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:46