MG_376_MONOMER

Name
WID MG_376_MONOMER View in model
 
Genetics
Gene MG_376 View in model
 
Structure
Sequence
1
51
101
MLNCVFLEGEIESTKWSHKKTGFLVTIKQKRLFGERSFTDFFVFYANGQL
AFELEAYTQKFKTISIEGILRTYLEKRSGIWKTTIEVVKIMKPNSKVMID
YQES*
50
100
105
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H881C565N139O156S4
Molecular weight (pH 7.5; Da) 12245.10 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
17085
Instability index 43.63
Is stable False
Aliphatic index 82.57
GRAVY (25C, pH 7.0) -0.214
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit
[c]: (6) MG_376_MONOMERMG_376_HEXAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homohexamer [PUB_0191].
References
  1. Das D, Hyun H, Lou Y, Yokota H, Kim R, Kim SH. Crystal structure of a novel single-stranded DNA binding protein from Mycoplasma pneumoniae. Proteins 67, 776-82 (2007). WholeCell: PUB_0191, PubMed: 17348019

 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:46