MG_375_MONOMER – threonyl-tRNA synthetase

Name
WID MG_375_MONOMER View in model
Name threonyl-tRNA synthetase View in model
Cross references PDB: 1QF6, PDB: 1TKY
 
Genetics
Gene MG_375 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
MLAGVLLLQIWLKCKYANVQFGEHGFNGDEFYLDFYINENFSTKQFAKIE
SDLNSLSSKLEGISQKFVSLDEALSFFENDQFTKNLLKKSNLNKFKITFF
ENKHFWIEDLTLTFIKKSFIKLLNVSVNYFLGDPSQLQLQRINGIFAQSK
KELEQLIKENEERLKKDHRSLGKQLELFSFDPLIGAGLPIWLAKGTTLRN
IIGNFVHHQQLLFGFNTVCSPVLANIELFKISGHYQHYKEDMFPAIKLDS
QAMMLRPMTCPHHCLIFKQKRYSYKKMPQRFSEDSILHRFEASGGLIGLE
RVRCMTLLDNHIFCRADQIKSEIKNAFNLIQKVNKKFGFIFDRIDLSLHD
PKNQSKFIDNPGLWRESESQMENVLKDLNIQYQKEIGAAAFYGPKIDFQF
KTIFKKMITIATIQLDFLLPEKFDLTYIDKKNTLKKPVIIHVGIIGTYER
FIAALLEKTSGNFPLWLAPVQAVIIPVNIQKHLKAAKKLYNKLLKENIRV
NLDDNQDRLAKKVRQAIIEKIPLQLIVGDKEIENLEKLTCRGFKGEKITR
ISFNNFVKRVRRDG*
50
100
150
200
250
300
350
400
450
500
550
565
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H4765C3012N791O816S16
Molecular weight (pH 7.5; Da) 65626.72 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
47745
Instability index 39.54
Is stable True
Aliphatic index 98.04
GRAVY (25C, pH 7.0) -0.254
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER, MG_392_393_21MER View in model
 
Function
Complex subunit threonyl-tRNA synthetase
[c]: (2) MG_375_MONOMERMG_375_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer. Coenzymes Interacts with 1 ZN per monomer as prosthetic group [96].
 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:46