MG_374_MONOMER

Name
WID MG_374_MONOMER View in model
 
Genetics
Gene MG_374 View in model
 
Structure
Sequence
1
51
101
151
201
251
MDRKIVVLDINTANFFNTTKDLEVWKNFFNFIQANNHQLVFMSSCWQQAV
LYLLDLLSLDDVDIIAESGAIIWISKTNEFIYQSFLDSVSIDTIVHHAII
TNSGVFAIGKSKISEEPNTTINYFISLEKYKQFKLIWLTEFDQTLKYQNF
LKNLSEMDVSSIYVFSPQYHLDFQLMEHISSGQPKFHYSNFYNENFLFTS
TKNSKFSALETYVKSKNCSLKDVHYLNVTEVPINNINQLASVVFLSKKQP
DNDEEFNNPEISIVLKGICEQLMK*
50
100
150
200
250
275
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2208C1460N355O428S8
Molecular weight (pH 7.5; Da) 31837.71 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
38765
Instability index 28.52
Is stable True
Aliphatic index 94.58
GRAVY (25C, pH 7.0) -0.120
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:46