MG_373_MONOMER

Name
WID MG_373_MONOMER View in model
 
Genetics
Gene MG_373 View in model
 
Structure
Sequence
1
51
101
151
201
251
MGFIKQYKTDFDIVDNQIVLSEQYFLRNKALFKKITGTRFGKVLGLSEYE
SSFKTWANMVKIYEDEFDETLAKAGNIIEPKIRDYVNLKTGFNFHSYDPK
KVQFDLFKDDSVFGGIPDGEPLDENGELAYQNDLPMLEIKTTSCDSLIYK
KINGNLKMILDENGMPIVKKKDGKKDSWFDSNGKIIISTLYYCQIGLYLY
LRNVNKGLFAIAFLKPEDYVLPEQFNASNREIRLIPIKIDHKGFSVLVDK
ARIWYENYILTGKSPKLTESDIQWLKENGIE*
50
100
150
200
250
282
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2304C1493N368O431S7
Molecular weight (pH 7.5; Da) 32528.84 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
44600
Instability index 24.89
Is stable True
Aliphatic index 90.21
GRAVY (25C, pH 7.0) -0.393
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:46