MG_370_MONOMER – 23S rRNA pseudouridine synthase; U1911, U1915, U1917

Name
WID MG_370_MONOMER View in model
Name 23S rRNA pseudouridine synthase; U1911, U1915, U1917 View in model
 
Genetics
Gene MG_370 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MRIANKFLVPKESENQRIDQFCLKILPLIKRSDFFKYLRLGKVLLNKTKP
QVNTRLKTKDEIAFLFDINPYLQTNNDYLSLDLVKDKLKIIFEDENIIVV
DKPTGIVCQPDKKHSIINLSNMLLKHCGYRQFDSNKLNFYPQFAHRIDRN
TSGIVIGAKTNKALKELNKVFKNNHLTKRYKGLVFGQFNHLGLQTAYWKK
DNNNGIVTVKWKPFPEAKKISTFFENSSYIAQKDMSLITIRLISGRTHQI
RACLNLFSNQLVGDKKYSLIQFKNRNNKYKHQALHAYELVFPKLETSKFP
ILTNYSLMQFKSKIVPWFEYLIQ*
50
100
150
200
250
300
324
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2782C1745N466O465S8
Molecular weight (pH 7.5; Da) 37986.01 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
36370
Instability index 20.49
Is stable True
Aliphatic index 93.86
GRAVY (25C, pH 7.0) -0.408
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0121, PUB_0122].
References
  1. Del Campo M, Ofengand J, Malhotra A. Purification and crystallization of Escherichia coli pseudouridine synthase RluD. Acta Crystallogr D Biol Crystallogr 59, 1871-3 (2003). WholeCell: PUB_0122, PubMed: 14501142

  2. Sivaraman J, Sauvé V, Larocque R, Stura EA, Schrag JD, Cygler M, Matte A. Structure of the 16S rRNA pseudouridine synthase RsuA bound to uracil and UMP. Nat Struct Biol 9, 353-8 (2002). WholeCell: PUB_0121, PubMed: 11953756

 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:45