MG_369_MONOMER – DAK2 phosphatase domain protein

Name
WID MG_369_MONOMER View in model
Name DAK2 phosphatase domain protein View in model
Cross references PDB: 1UOE
 
Genetics
Gene MG_369 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
MSSVNLSSFIDMLRLGCNNIAKNYEYINQLNVFPVPDGDTGTNMKVTITE
AIKKLENEKSHIKSFSELGKNFTRDLLLFSRGNSGVIFSQIMKGFFSNII
VNKTSNNSELSIEDVANAFIVAQEVAYKNVSKPVEGTMLTVARLISNEFK
SQKNRPKTLEKLFEQAVKVAWQAVKKTPQMLPVLKASGVVDSGAYGFACF
LEGMLSYYGGESNLDDNTLSTIEIKFNKFKEQHANEDEFGYCTEYVLRLG
LKINQTVEKQKFHQKKFESKVNRIANSVVIASDKDNGFVKVHAHTLKPHL
LLEMGLNYGEFEFVKIDNMNLQVNNKNNSPTKRVLKPAIVATVPTEAFAE
RIREDHDINAILCTDDTGAPSVFSLLEAVKLTNSSNVIFLLHDKNYFLSA
NETIKQLKHQKINADYVITANPVESIAALTVFNSDLSIHTNVKAMKRFIK
EFASATITQASKSYKENKVMVNKNDFIAVTNKSIIASESQLTDCFFKTID
ILSKKVKKPEFLLAYYGKDITEQDAKKMQALVEKKYKLFCEFSPGEQKVF
SYIIGIQ*
50
100
150
200
250
300
350
400
450
500
550
558
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H4482C2819N737O838S18
Molecular weight (pH 7.5; Da) 62683.18 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
30090
Instability index 27.32
Is stable True
Aliphatic index 89.27
GRAVY (25C, pH 7.0) -0.239
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit DAK2 phosphatase domain protein
[c]: (2) MG_369_MONOMERMG_369_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer.
 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:45