MG_368_MONOMER – fatty acid/phospholipid synthesis protein PlsX

Name
WID MG_368_MONOMER View in model
Name fatty acid/phospholipid synthesis protein PlsX View in model
 
Genetics
Gene MG_368 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MAFRFAVDCLGFENKPSEAIEAVLKYWSFHQDLNFILIGDEKAFDGLDIL
PKNITKKLANSFIEMTDTPLSARRKVNSSMQIAINLVREGNADVVISAGS
SAVYASLTNDAFGKINKNTKSAFMSYVPTDNNNWFYFLDVGANKYFTGKE
LYFLGLMADIFVKKTTTKKTPKIGLLNIGTEENKGFDYHQEAFKLLKADK
NLNFLGFVESRFLLDGICDILIADGYSGNLVLKAMEGTFKTIARILKRGY
KRNPLAGLFSLGIIKSVAKKFDYKNNAGAVVMGLNKLALKTHGSADKQQF
LSTIRLAHLSLKSDLINAIKTSLNNYEE*
50
100
150
200
250
300
329
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2628C1662N430O475S9
Molecular weight (pH 7.5; Da) 36521.73 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
27640
Instability index 26.27
Is stable True
Aliphatic index 94.35
GRAVY (25C, pH 7.0) -0.0842
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit fatty acid/phospholipid synthesis protein PlsX
[c]: (2) MG_368_MONOMERMG_368_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0376].
References
  1. Kim Y, Li H, Binkowski TA, Holzle D, Joachimiak A. Crystal structure of fatty acid/phospholipid synthesis protein PlsX from Enterococcus faecalis. J Struct Funct Genomics 10, 157-63 (2009). WholeCell: PUB_0376, PubMed: 19058030

 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:45