MG_367_MONOMER – ribonuclease III

Name
WID MG_367_MONOMER View in model
Name ribonuclease III View in model
 
Genetics
Gene MG_367 View in model
 
Structure
Sequence
1
51
101
151
201
251
MKNKVLKLKNNKIFDKKLATFLKNLDIFPNNWEFFEKAFIHASYINEHED
VSESYDRLEFLGDALIDFVVAKKLFELYPKYNEGLLTRTKIEIVKGENLN
RIGMELKLGDFVKLSNGAELTENTVGDVLEALVGAIYEDMGMKKATEFVE
KYIFERTFSEILKYDFFSLFQEQKLPEPRVRVSLTSNNLVLSIIELDGDI
IWSQAIPNNKNYDDKSVLEHNAMASFTSFLKSSKGSHFFSDLKEKIENQK
MCKKLAIKPKKN*
50
100
150
200
250
263
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H2170C1387N347O401S7
Molecular weight (pH 7.5; Da) 30346.52 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
23045
Instability index 24.20
Is stable True
Aliphatic index 91.56
GRAVY (25C, pH 7.0) -0.348
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Function
Complex subunit ribonuclease III
[c]: (2) MG_367_MONOMERMG_367_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0039]. Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group [PUB_0039].
References
  1. Nicholson AW. Function, mechanism and regulation of bacterial ribonucleases. FEMS Microbiol Rev 23, 371-90 (1999). WholeCell: PUB_0039, PubMed: 10371039

 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:45