MG_366_MONOMER

Name
WID MG_366_MONOMER View in model
 
Genetics
Gene MG_366 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
MITKSFFLKNFDRSKELIPLSYNDVFSAVNQFLKSYTDVNDIDIIEENLI
EDPVFELDVLELLNEDPMLLLDSKNPRVQEAKIIANKAKKNIKDYFNLPI
FFDTDSLDKNVSVYQKAELTEKKIQEIITSKKSAIIFKPIFEIEDCLIQP
DAIIVHEKGLCEFVVIKATTNTKRKYFLEIIYDFVLFKKIGKYKLLNYYF
CTVKYELQNKNNVSFFLNTEIKTSKNSFSLSSKEKDYFKNKPFNHPEKIA
YIHKKKSNGVNGFLIVKLIDNLIKNNIVDLNKISDFVTKEIDSKSVRNIQ
PLIKNAAKIQINFWDQIQDIKKYQELKINQIVFNYSENFDSFWSNYLLRN
LIKLVFAHKYNEIFKLSGKLANWSQLTYAYKENKSITINQLLHELNQKKS
KANFNNSTNKISFFLEAWNSEKGFAIGNKFKNTWNKLKKKKVYFDFETIS
SSIRIINNSLPFSQIVTQCSLIVDKNEIDDKRKLNCENLIFDPLFISVND
FKKVIDSLYQNNCSDYSFVVFNKSFEKNRLLEMATLINEQIYKEKVKAIV
DNLFDLADIFTIENNCLAFKQLNGFSSIKKVLTIIDESFLKASKSIGYQN
LKIQKGDVAQEVALSRFLNCLNKNEWNQVAFELKKYCENDVRAMISIVLF
IQDLIKKNDLFTFYSEN*
50
100
150
200
250
300
350
400
450
500
550
600
650
668
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H5634C3592N895O1023S13
Molecular weight (pH 7.5; Da) 78141.17 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
71375
Instability index 23.87
Is stable True
Aliphatic index 98.92
GRAVY (25C, pH 7.0) -0.288
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:45