MG_365_MONOMER – methionyl-tRNA formyltransferase

Name
WID MG_365_MONOMER View in model
Name methionyl-tRNA formyltransferase View in model
Cross references PDB: 2FMT
 
Genetics
Gene MG_365 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MFKIVFFGTSTLSKKCLEQLFYDNDFEICAVVTQPDKINHRNNKIVPSDV
KSFCLEKNITFFQPKQSISIKADLEKLKADIGICVSFGQYLHQDIIDLFP
NKVINLHPSKLPLLRGGAPLHWTIINGFKKSALSVIQLVKKMDAGPIWKQ
QDFLVNNDWNTGDLSIYVEEHSPSFLIECTKEILNKKGKWFEQIGEPTFG
LNIRKEQEHLDLNQIYKSFLNWVKGLAPKPGGWLSFEGKNIKIFKAKYVS
KSNYKHQLGEIVNISRKGINIALKSNEIISIEKIQIPGKRVMEVSEIING
KHPFVVGKCFK*
50
100
150
200
250
300
312
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2585C1636N422O444S9
Molecular weight (pH 7.5; Da) 35558.07 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
42690
Instability index 38.43
Is stable True
Aliphatic index 97.12
GRAVY (25C, pH 7.0) -0.220
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme methionyl-tRNA (MG488) formyltransferase
[c]: FTHF10 + METFMET + THF
View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0364].
References
  1. Guillon JM, Meinnel T, Mechulam Y, Lazennec C, Blanquet S, Fayat G. Nucleotides of tRNA governing the specificity of Escherichia coli methionyl-tRNA(fMet) formyltransferase. J Mol Biol 224, 359-67 (1992). WholeCell: PUB_0364, PubMed: 1373194

 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:45