MG_364_MONOMER – Replication initiation/membrane attachment protein

Name
WID MG_364_MONOMER View in model
Name Replication initiation/membrane attachment protein View in model
 
Genetics
Gene MG_364 View in model
 
Structure
Sequence
1
51
101
151
201
MDGGQQGSFFGLLVIVIPIILLIVFFSKKKGAQKNDFSGEGGNRSSRKDE
VWKTIKQFLQEKNERGKEIIKTFVAKKPNPLHSKKDRKLFNQEIQAYITS
NNLGKSEAKRYKNEQTRLMQRELYCIYFVTKDAKSTEVDDARIIEAEVYQ
KPTKTKSTPERLIRILGLKNFETEMQWIQPLMVREEKRKEKEEQKKLKLA
ARELKKKKKKKIKKPKEIRNQKNV*
50
100
150
200
225
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1978C1183N336O333S5
Molecular weight (pH 7.5; Da) 26396.66 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
18575
Instability index 25.66
Is stable True
Aliphatic index 77.56
GRAVY (25C, pH 7.0) -0.943
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:45