MG_363_MONOMER – ribosomal protein L32

Name
WID MG_363_MONOMER View in model
Name ribosomal protein L32 View in model
Cross references PDB: 1P86, PDB: 2Z4N
 
Genetics
Gene MG_363 View in model
 
Structure
Sequence
1
51
MAVQQRRSSKHRRDKRRSHDALTLQTLSVCKKCGKKKLSHRVCSCGMYGE
LRVKKAH*
50
58
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H493C277N101O76S6
Molecular weight (pH 7.5; Da) 6646.88 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
1990
Instability index 78.35
Is stable False
Aliphatic index 58.79
GRAVY (25C, pH 7.0) -1.01
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit 50S ribosomal subunit
[c]: MGrrnA23S + MGrrnA5S + MG_081_MONOMER + MG_082_MONOMER + MG_093_MONOMER + MG_151_MONOMER + MG_152_MONOMER + MG_153_MONOMER + MG_154_MONOMER + MG_156_MONOMER + MG_158_MONOMER + MG_159_MONOMER + MG_161_MONOMER + MG_162_MONOMER + MG_163_MONOMER + MG_166_MONOMER + MG_167_MONOMER + MG_169_MONOMER + MG_174_MONOMER + MG_178_MONOMER + MG_197_MONOMER + MG_198_MONOMER + MG_232_MONOMER + MG_234_MONOMER + MG_257_MONOMER + MG_325_MONOMER + MG_361_MONOMER + MG_362_MONOMER + MG_363_MONOMER + MG_418_MONOMER + MG_426_MONOMER + MG_444_MONOMER + MG_466_MONOMER + MG_473_MONOMERRIBOSOME_50S
View in model
 
Comments
Comments Functional Macromolecule Functional as part of 50S ribosomal particle.
 
Metadata
Created 2012-10-01 15:08:00
Last updated 2012-10-01 15:14:45