MG_360_MONOMER – ImpB/MucB/SamB family protein

Name
WID MG_360_MONOMER View in model
Name ImpB/MucB/SamB family protein View in model
Cross references PDB: 1UNN
 
Genetics
Gene MG_360 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MINTFTYFEPEYLIDKNLIFLYFDFDAFFASVEELENPELVNQPLIVGNR
FSRSVVSTCNYVARSYGIRSGMSILKALELCPNAIFAHSNFRNYRKHSKR
IFSVIESTFSLKIDVLSVDEGVACFQNISFKKAFLIAKKIKNFVFQNLRI
KISIGISDHFLIAKIFSNQAKPFGIKSCSVKDIKKKLWPLPITEIPGIGE
KHIDLVFKNNFYKINDLAVCEDASLLKKVFGNFWESLKAVSLGKWYTDNN
NQVKSRSFAVSETLEDLNYSNNQLNKKLTQIFDQLFIRLQLSSQVCKGIV
VQLKSNDFIVNSHSNKMKKYSNDYRKLLSITKRLFNRLLINTEKNVRLIG
ISFFDLKKIDTDEGQKKSLFYQFIPKSISKLSEESSLDKLIFDINESFGF
EIIKRANKLKS*
50
100
150
200
250
300
350
400
412
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3447C2181N561O605S9
Molecular weight (pH 7.5; Da) 47495.55 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
35130
Instability index 28.21
Is stable True
Aliphatic index 98.64
GRAVY (25C, pH 7.0) -0.136
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0138].
References
  1. Wagner J, Gruz P, Kim SR, Yamada M, Matsui K, Fuchs RP, Nohmi T. The dinB gene encodes a novel E. coli DNA polymerase, DNA pol IV, involved in mutagenesis. Mol Cell 4, 281-6 (1999). WholeCell: PUB_0138, PubMed: 10488344

 
Metadata
Created 2012-10-01 15:07:59
Last updated 2012-10-01 15:14:45