MG_359_MONOMER – Holliday junction DNA helicase RuvB

Name
WID MG_359_MONOMER View in model
Name Holliday junction DNA helicase RuvB View in model
 
Genetics
Gene MG_359 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MKLQIKPPNTFDEFVGKQEIISQIQLSIKASKLNKTQLDHILLYGPPGVG
KTTLARLIANELKTKLQIIQGGHLQKPSDFLNAISLIKKGDVLFIDEIHA
VAPNVMELMYPVMDVFKIQVLIGKDFNSKIVEMKVNPFTLIGATTQLGKI
INPLEDRFGVILNINYYSNAEIEKMVSIYGKQMKLELNSNEISAITEHSK
QTPRIAIRIVRRIFEQKIVNKKIDLEGLFKNLMIYKNGLQSIDVQYLEVL
NRQNEPQGIKSISSMLGIDRHTIENKIEPFLLRENMIQKTKKGRIITNSG
REYLVNF*
50
100
150
200
250
300
308
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2606C1584N421O447S10
Molecular weight (pH 7.5; Da) 35020.74 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
11920
Instability index 33.88
Is stable True
Aliphatic index 111.69
GRAVY (25C, pH 7.0) -0.148
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit Holliday junction DNA helicase
[c]: (4) MG_358_MONOMER + (6) MG_359_MONOMERMG_358_359_10MER
View in model
 
Comments
Comments Functional Macromolecule M. genitalium only contains RuvA and RuvB of the canonical RuvABC complex. Functional as 14-mer RuvAB heterocomplex (see MG_358_359_14MER) [PUB_0432].
References
  1. Yamada K, Ariyoshi M, Morikawa K. Three-dimensional structural views of branch migration and resolution in DNA homologous recombination. Curr Opin Struct Biol 14, 130-7 (2004). WholeCell: PUB_0432, PubMed: 15093826

 
Metadata
Created 2012-10-01 15:07:59
Last updated 2012-10-01 15:14:45