MG_357_MONOMER – acetate kinase

Name
WID MG_357_MONOMER View in model
Name acetate kinase View in model
Cross references PDB: 1LRG
 
Genetics
Gene MG_357 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MQSHKILVVNAGSSSIKFQLFNDKKQVLAKGLCERIFIDGFFKLEFNQKK
IEEKVQFNDHNLAVKHFLNALKKNKIITELSEIGLIGHRVVQGANYFTDA
VLVDTHSLAKIKEFIKLAPLHNKPEADVIEIFLKEIKTAKNVAVFDTTFH
TTIPRENYLYAVPENWEKNNLVRRYGFHGTSYKYINEFLEKKFNKKPLNL
IVCHLGNGASVCAIKQGKSLNTSMGFTPLEGLIMGTRSGDIDPAIVSYIA
EQQKLSCNDVVNELNKKSGMFAITGSSDMRDIFDKPEINDIAIKMYVNRV
ADYIAKYLNQLSGEIDSLVFTGGVGENASYCVQLIIEKVASLGFKTNSNL
FGNYQDSSLISTNESKYQIFRVRTNEELMIVEDALRVSTNIKK*
50
100
150
200
250
300
350
394
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H3177C2000N529O584S12
Molecular weight (pH 7.5; Da) 44361.47 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
25495
Instability index 26.85
Is stable True
Aliphatic index 95.74
GRAVY (25C, pH 7.0) -0.191
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit acetate kinase
[c]: (2) MG_357_MONOMERMG_357_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer. Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group.
 
Metadata
Created 2012-10-01 15:07:59
Last updated 2012-10-01 15:14:45