MG_355_MONOMER – ATP-dependent Clp protease, ATPase subunit

Name
WID MG_355_MONOMER View in model
Name ATP-dependent Clp protease, ATPase subunit View in model
Cross references PDB: 1KHY
 
Genetics
Gene MG_355 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
MNINFTPAGENRNFLQEIGRNINDEVLKNKVDPIIGRDNEIRRLIEILSR
KSKNNPVLIGEPGVGKTAIVEGFVRRVVSNDVPLNLRDVEIYELSLSGLI
AGTKFQGEFEKRINTILKQVKESNGRIILFIDEIHQIVGLGRNSSSGAMD
IANILKPMLARGEIKVIGATTLKEYREYIEKDGALERRFQKILINEPSSQ
EALTIMRGLKTRWELFHNITIFDSALVAAVEMSTRYINERNLPDKAIDLI
DEAAAKIKTEMSSEPVAIDSLKREIINLETEYAALKQDKENDNKQSKKEY
LEKLKKQLDALKQKRDSLINEWKKEKADFENINKLKKEIEEFQTKLETYQ
SEGNYESASKILYSDIPRLKKELESAQQKYATSKHDLFKTEVSENEIAEV
ISQTTGIPLKKLLESEKDKLLHLGDEIKKRVKGQDEAIDAVVNTVIRGRV
NINDPNKPIGSFIFLGSTGVGKTELAKSLAEVLFDNEKALIRFDMSEYME
KHSVAKLIGAPPGYIGYEQSGLLTEAVRRKPYSVLLFDEIEKAHPDVTNV
LLQVLDDGTLKDSQGRVVNFKNTLIIMTSNLGSNFLLEGKKDLAIQSLKK
HFRPEFINRIDEIVFFNVLEKDTVLSIINSLLAQLSKRLNKQNLFFNFDS
NLTEFIYKSSFDQQFGARPIKRFIDHSVATLIAKYILQGKIKKGVGYNIA
VVKDNITITQNNKS*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
715
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H5897C3625N986O1092S9
Molecular weight (pH 7.5; Da) 81052.91 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
36330
Instability index 42.77
Is stable False
Aliphatic index 100.91
GRAVY (25C, pH 7.0) -0.398
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit ATP-dependent Clp protease, ATPase subunit
[c]: (6) MG_355_MONOMERMG_355_HEXAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homohexamer [PUB_0006].
References
  1. Keseler IM, Bonavides-Martínez C, Collado-Vides J, Gama-Castro S, Gunsalus RP, Johnson DA, Krummenacker M, Nolan LM, Paley S, Paulsen IT, Peralta-Gil M, Santos-Zavaleta A, Shearer AG, Karp PD. EcoCyc: a comprehensive view of Escherichia coli biology. Nucleic Acids Res 37, D464-70 (2009). WholeCell: PUB_0006, PubMed: 18974181

 
Metadata
Created 2012-10-01 15:07:59
Last updated 2012-10-01 15:14:44