MG_354_MONOMER

Name
WID MG_354_MONOMER View in model
Cross references PDB: 1TM9
 
Genetics
Gene MG_354 View in model
 
Structure
Sequence
1
51
101
MEQNNIKEQLISFFNQACSTHQERLDFICSTRESDTFSSVDVPLEPIKNI
IEITKDENQQIEITKIAVNNIKTLSSVGATGQYMASFFSTNSEPAIIFCV
IYFLYHFGFLKDNNKKQIIKKAYETIADNIADYLNEN*
50
100
138
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1082C703N178O220S5
Molecular weight (pH 7.5; Da) 15707.46 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
7825
Instability index 46.92
Is stable False
Aliphatic index 86.96
GRAVY (25C, pH 7.0) -0.262
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:59
Last updated 2012-10-01 15:14:44