MG_353_MONOMER – DNA-binding protein HU, putative

Name
WID MG_353_MONOMER View in model
Name DNA-binding protein HU, putative View in model
 
Genetics
Gene MG_353 View in model
 
Structure
Sequence
1
51
101
MEKTSNTSKPLSRSEINKIIAVATGIKEKKIKEIFKYLNTLLLNELVSRS
VCILPENLGKLRITIRNARYQKDMQTGEIRHIPPKPLVRYSPSKTIKETA
AKVRWKYAD*
50
100
110
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H956C563N159O158S3
Molecular weight (pH 7.5; Da) 12576.74 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
11585
Instability index 42.48
Is stable False
Aliphatic index 96.64
GRAVY (25C, pH 7.0) -0.515
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit DNA-binding protein HU, putative
[c]: (2) MG_353_MONOMERMG_353_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0085, PUB_0377, PUB_0378].
References
  1. Fujiwara S, Yonezawa Y. The structural information on the DNA-binding protein HU in solution obtained by the small-angle neutron scattering experiments. J Phys Chem Solids 60, 1393-5 (1999). WholeCell: PUB_0377, URL: http://www.sciencedirect.com/science/article/pii/S0022369799001262?_alid=1836137335&_rdoc=1&_fmt=high&_origin=search&_docanchor=&_ct=1&_zone=rslt_list_item&md5=58f2bf776bfab73a18a6c01e267a04a4

  2. Rouvière-Yaniv J, Kjeldgaard NO. Native Escherichia coli HU protein is a heterotypic dimer. FEBS Lett 106, 297-300 (1979). WholeCell: PUB_0378, PubMed: 227733

  3. Rouvière-Yaniv J, Yaniv M, Germond JE. E. coli DNA binding protein HU forms nucleosomelike structure with circular double-stranded DNA. Cell 17, 265-74 (1979). WholeCell: PUB_0085, PubMed: 222478

 
Metadata
Created 2012-10-01 15:07:59
Last updated 2012-10-01 15:14:44