MG_351_MONOMER – inorganic pyrophosphatase

Name
WID MG_351_MONOMER View in model
Name inorganic pyrophosphatase View in model
Cross references PDB: 2EIP
 
Genetics
Gene MG_351 View in model
 
Structure
Sequence
1
51
101
151
MDKFLIDVIVEIPKNSKIKYEYDRQTGQIRVDRILFGSESYPQNYGFIKN
TLDWDGDELDCFIFADQPFLPATVVPTRIVGALEMIDDGEIDTKLLGVID
CDPRYKEINQISDLPKHRIEEILIFLKTYKLLQKKTVIIKGLKDVCWAKK
EYEICLQLMKDYGHLSKDQFIQKMQILHPEHYQK*
50
100
150
185
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H1549C989N247O281S8
Molecular weight (pH 7.5; Da) 21651.83 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
24910
Instability index 30.73
Is stable True
Aliphatic index 100.59
GRAVY (25C, pH 7.0) -0.334
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Function
Complex subunit inorganic pyrophosphatase
[c]: (6) MG_351_MONOMERMG_351_HEXAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homohexamer. Coenzymes Interacts with 4 MG per monomer as prosthetic group [96].
 
Metadata
Created 2012-10-01 15:07:59
Last updated 2012-10-01 15:14:44