MG_350_MONOMER

Name
WID MG_350_MONOMER View in model
 
Genetics
Gene MG_350 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MKISPDQKDKKSLFKKHFAYLKLTEKELNDPKIQTLLEVAWNHFDQCRKI
KERRCSNKGDIHLQAVREWLPWEFNANQLKKNSTKETTQVSENEFMGNVM
LMQTICPKLVNKANWFDLTYERFIVTKPNWFKYMDLIPMIQNLPVTPSDK
NSFGYAYKKISNLFETEKKTKKRIFFFNLQKNNINNMAACMLTCEIAKKN
IKVALIYCEEFVSRYDKSYWKVDDDLNLLDEAKVIIFIGLGQESFHNKNY
ILFMTRLFINCFLKRKDVFFFSTTYSDGNGLIQTFKNQIISSANWVKHFF
EQLNDLLMINI*
50
100
150
200
250
300
312
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2630C1693N435O463S17
Molecular weight (pH 7.5; Da) 37030.63 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
54275
Instability index 27.93
Is stable True
Aliphatic index 82.18
GRAVY (25C, pH 7.0) -0.410
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:07:59
Last updated 2012-10-01 15:14:44