MG_349_MONOMER – Replication initiation/membrane attachment protein

Name
WID MG_349_MONOMER View in model
Name Replication initiation/membrane attachment protein View in model
 
Genetics
Gene MG_349 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MEDSVLYSFYFWTYMQPNYYRVIKKATSFSGLEMISHAYGQIAGVEVVGF
YLWLITEANIQAFNSEIRTPISRLQNAFNPFEIKKNQVSEWIYKTISKLE
SLGLVRTFFSPKRSEITFCIIDPLDWKEFKQNKQLKEKLVEAMGKVEYDR
NCLAFDQIDNLQFDNALEISANFEVNFTANQSDVWFSFNFEELHKELVKN
KLLISLDEKAKTLINGYFEKYKLSLQQITDCIINSSTQENELDFQKLEMM
FFQIVKNDTAPILETVSNNKDFFYKNEILDESTKKAITDCHVNFNSEKYL
FLLYGKIDESQLQLVRQLRSDYQLLDKVINLVLDFSFWKNNGMWREKYIL
KIAQSIKINNSQNSYEKTLNNFIRALTLNKKHSLNNIKPVEKTISFTEYF
EFIK*
50
100
150
200
250
300
350
400
405
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3355C2191N544O632S11
Molecular weight (pH 7.5; Da) 47780.93 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
65820
Instability index 36.96
Is stable True
Aliphatic index 89.78
GRAVY (25C, pH 7.0) -0.344
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit Replication initiation/membrane attachment protein
[c]: (6) MG_349_MONOMERMG_349_HEXAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homohexamer [PUB_0110].
References
  1. Chen J, Anderson JB, DeWeese-Scott C, Fedorova ND, Geer LY, He S, Hurwitz DI, Jackson JD, Jacobs AR, Lanczycki CJ, Liebert CA, Liu C, Madej T, Marchler-Bauer A, Marchler GH, Mazumder R, Nikolskaya AN, Rao BS, Panchenko AR, Shoemaker BA, Simonyan V, Song JS, Thiessen PA, Vasudevan S, Wang Y, Yamashita RA, Yin JJ, Bryant SH. MMDB: Entrez's 3D-structure database. Nucleic Acids Res 31, 474-7 (2003). WholeCell: PUB_0110, PubMed: 12520055, URL: http://www.ncbi.nlm.nih.gov/Structure/

 
Metadata
Created 2012-10-01 15:07:59
Last updated 2012-10-01 15:14:44