MG_347_MONOMER – tRNA (guanine-N(7)-)-methyltransferase

Name
WID MG_347_MONOMER View in model
Name tRNA (guanine-N(7)-)-methyltransferase View in model
 
Genetics
Gene MG_347 View in model
 
Structure
Sequence
1
51
101
151
201
VRLRKVKNALLKINQSPYFYSKDKFAKFTKKQLVLELGCGKGTFLIKEAQ
KNNNFLFIGIEREPTIVLKAINKINKLDFNLENILLLCTDAKQLDDYFQA
ESVQKIFINFPDPWPKKRHIQRRLTSPDFLKLFWNLLVKNGLIEFKTDND
KLFEYTLTTLQENSQIFEIIHQITDLNNSEFSFQNSITEYEQRFMELEIP
IKKLVIKKII*
50
100
150
200
211
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Empirical formula (pH 7.5) H1830C1154N292O314S3
Molecular weight (pH 7.5; Da) 24914.77 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
18700
Instability index 36.69
Is stable True
Aliphatic index 103.03
GRAVY (25C, pH 7.0) -0.307
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Function
Complex subunit tRNA (guanine-N(7)-)-methyltransferase
[c]: (2) MG_347_MONOMERMG_347_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0050]. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  2. Zegers I, Gigot D, van Vliet F, Tricot C, Aymerich S, Bujnicki JM, Kosinski J, Droogmans L. Crystal structure of Bacillus subtilis TrmB, the tRNA (m7G46) methyltransferase. Nucleic Acids Res 34, 1925-34 (2006). WholeCell: PUB_0050, PubMed: 16600901

 
Metadata
Created 2012-10-01 15:07:59
Last updated 2012-10-01 15:14:44