MG_346_MONOMER – 23S rRNA methyltransferase; U2552

Name
WID MG_346_MONOMER View in model
Name 23S rRNA methyltransferase; U2552 View in model
 
Genetics
Gene MG_346 View in model
 
Structure
Sequence
1
51
101
151
MYKSVINIVLFCPEIPNNTGNIVRSCTAFKANLHLIKPYGFFLNDKRMVR
AGLNCWDKIQLFEHKSWEHFLQATTENKTIWLLTKSGDKTPDQICMTNKL
PNELYFVFGQETKGLPKTIMDNFKQNQIRIPIWNSVRSINLANAVVCILY
EYSKQNQYSNLDKQCA*
50
100
150
167
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1365C874N232O243S10
Molecular weight (pH 7.5; Da) 19331.19 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
31690
Instability index 36.01
Is stable True
Aliphatic index 85.81
GRAVY (25C, pH 7.0) -0.308
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit 23S rRNA methyltransferase
[c]: (2) MG_346_MONOMERMG_346_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0123, PUB_0124].
References
  1. Mallam AL, Jackson SE. Probing nature's knots: the folding pathway of a knotted homodimeric protein. J Mol Biol 359, 1420-36 (2006). WholeCell: PUB_0124, PubMed: 16787779

 
Metadata
Created 2012-10-01 15:07:59
Last updated 2012-10-01 15:14:44