MG_345_MONOMER – isoleucyl-tRNA synthetase

Name
WID MG_345_MONOMER View in model
Name isoleucyl-tRNA synthetase View in model
 
Genetics
Gene MG_345 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
851
MDLKKTLLMPKTSFAMQANLSTSEKNFHDFWKDKKVFQKLKKQNKGKQIK
ILHDGPPYANGSIHVGHALNKILKDFILRSWLYEGYDVVFIPGWDCHGLP
IEHAVSKKNPSSYSNLSTVEKRKLCHQFALSQIAVQKEQFQRLGLLNDFQ
NCYYTIDESFQFKELELFLQAIKKGLIFQDLKPTYWSPISRTSLAEAEIE
YKEVNSIALYLTFKVSKSDFLDENANLLVWTTTPWTLPTNQAIAIHPDFD
YLLFEYNQQKFVILEKLFEVFTNKLNWTNAIKLKKFKGSNLKNSSYSHCF
YNKVLPVLMGIHVVDNEGTGIVHSSPAFGIDDFYLCQKNKIKEVLISIDE
KGVFNNLLNDKELENCFYLKANDLIINRLKQNNSFIFSEVISHREPHDWR
SKTPVIYRASKQLFIKTKSIKKQLKKQINQVNFLNSKNQLRLKEMLLQRD
EWCISRQRVWGLPIPIVYANNKPLLDFSTIQYTIKQLKKHGIDSWFEKDV
TCFLKPDKTKKWVKYHKEIDTLDVWFDSGSSYNVLEINKYGSIADLYIEG
SDQYRGWFNSSSNCGIIQNDLIPFKSLVSHGFTLDENGNKMSKSLGNIVD
PLKICDQYGADILRLWVANTDWQIDNKIGVNILKQVAEQYRRIRNSLLRF
ILGNINGFNFTSMDDYKFSLEDKIVIHKTNSLVEQIEKFLEKYNFLGCLK
VINKFVLWLSSWYFEIIKDTLYCDAKNNPNRLAKQAVLNYIFTQLISFLN
IFIPHTAEDAWKNYSFNKKPISVNLFTKPTVFKVANSKNLENIYKTFTSI
KNAAFKEIEKLRKEGLISKNNQIELTVGINKKIPKKLKDNLALWLNVNSV
NLTNNENEIKVKKTKKTMCERCWNFQTIIKQKLDHNLCSRCFKVC*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
896
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H7492C4789N1243O1327S25
Molecular weight (pH 7.5; Da) 104513.59 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
165305
Instability index 27.37
Is stable True
Aliphatic index 92.89
GRAVY (25C, pH 7.0) -0.365
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0095, PUB_0363]. Coenzymes Interacts with 1 ZN per monomer as prosthetic group [96]. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Dureković A, Flossdorf J, Kula MR. Isolation and properties of isoleucyl-tRNA synthetase from Escherichia coli MRE 600. Eur J Biochem 36, 528-33 (1973). WholeCell: PUB_0363, PubMed: 4581276

  2. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  3. Hunter S, Apweiler R, Attwood TK, Bairoch A, Bateman A, Binns D, Bork P, Das U, Daugherty L, Duquenne L, Finn RD, Gough J, Haft D, Hulo N, Kahn D, Kelly E, Laugraud A, Letunic I, Lonsdale D, Lopez R, Madera M, Maslen J, et al. InterPro: the integrative protein signature database. Nucleic Acids Res 37, D211-5 (2009). WholeCell: PUB_0095, PubMed: 18940856, URL: http://www.ebi.ac.uk/interpro/

 
Metadata
Created 2012-10-01 15:07:59
Last updated 2012-10-01 15:14:44