MG_342_MONOMER – NADPH-dependent FMN reductase domain protein

Name
WID MG_342_MONOMER View in model
Name NADPH-dependent FMN reductase domain protein View in model
Cross references PDB: 1QFJ
 
Genetics
Gene MG_342 View in model
 
Structure
Sequence
1
51
101
151
MSKDQKSLILMLSNSQHSINRKFANELKHSLSCELIELKDYQVDFYSVDL
EATNFPDKIKTLVRKIKEHSNLIFVTPEHNGFIPAFAKNIIDWMTRDEQY
GRNQFLKGLNGVICCVTPATAGGGKTVLELLDKFLSFSGLNVKGTVLVNG
YHENFDFKPFIEQVKKLI*
50
100
150
169
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1366C869N226O248S6
Molecular weight (pH 7.5; Da) 19139.85 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
11835
Instability index 17.66
Is stable True
Aliphatic index 93.96
GRAVY (25C, pH 7.0) -0.191
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0362]. Stable modifications Phosphorylation observed by mass-spec [PUB_0094].
References
  1. Ohshiro T, Yamada H, Shimoda T, Matsubara T, Izumi Y. Thermostable flavin reductase that couples with dibenzothiophene monooxygenase, from thermophilic Bacillus sp. DSM411: purification, characterization, and gene cloning. Biosci Biotechnol Biochem 68, 1712-21 (2004). WholeCell: PUB_0362, PubMed: 15322355

  2. Su HC, Hutchison CA 3rd, Giddings MC. Mapping phosphoproteins in Mycoplasma genitalium and Mycoplasma pneumoniae. BMC Microbiol 7, 63 (2007). WholeCell: PUB_0094, PubMed: 17605819

 
Metadata
Created 2012-10-01 15:07:59
Last updated 2012-10-01 15:14:43