MG_341_MONOMER – DNA-directed RNA polymerase, beta subunit

Name
WID MG_341_MONOMER View in model
Name DNA-directed RNA polymerase, beta subunit View in model
 
Genetics
Gene MG_341 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
851
901
951
1001
1051
1101
1151
1201
1251
1301
1351
MSQKSNFFQKRYSPTATRRYYGKIETNFIQPNLADIQIKSYQKFLDHDLE
KLIASYFPIKSPNDRYTINFRGLHRTEPERDEAQSRAQSKTYEVGIYADL
ELVDNDKGTVKKARKSKKNIASNTNGVFLASMPLITHDGVFIINGIEKFV
ISQITRSPGIYMLTKSQLKLSNSRKRVQEGYVCEVLPANGSVMLIYISNK
KKIEDAFVQILLRDAVREGAKIFPITTLLKAFGLNNREILKIFKNNEFIK
RSLEAEIYNAKDFLSNVDPEIKNLLKEFRDGKTDLRRKGIASDQKLRSLV
NEYVTLEKQYNALKQTSPNDSSLTALELEMENKMDSVITERAAKHIVNEL
SISLRDIENTEECHEVSFHALLCARFFRNKRYNLSNAGRYKVSRKLRLTE
RIYQKTLACDLFLKDGKLLLKKGTLLLKEEIDKIKQAAKNNEISFVNKMQ
LTTDGKAVDLAKESLFYETIDVYITNDNLSVSVPVIGIHNENDLNKAMTL
SDFIASISYVINLPYGIGKYDDIDHLGNKRVKLINELITAKLESGFTRME
RFLKEKLTIADGVNRGQQINEEGQVIEQGEKKELTIKSLINSKPIQIVIK
DFFNTHQLTQFLDHQNPLSELSNKRRISAMGPGGISREDPNLDIRDVHYS
QYGRICPIETPEGMNIGLIMSLASFAKIDENGFLMAPYRKIKAGVITDEV
EYLTALREDEHIIAEISSLVNISNDNKILDKEIIGRYRSMQGLYDPLKID
YIDVAPHQVVSIGSSLIPFLENDDSARALMGTNMQRQAYPLIKPYAPAVG
TGQEHKIASDSGLTMSSPCSGVVSYVDNSKIIITSDSSKKETVNLVKFER
SNQNTCYNHKPIVEIGQRVNKDEIIVDGPAVNKSELALGQNVLVAFTTWN
GYNYEDAIVISERLVKEDILTSLTINEYVAQCLSTKNGDEQITRDIPNVS
DANKRYLDENGIIMVGAEVKEGDVLVGKVSPKGQVEVSPEEKLFKAIFPE
SVQNVRDSSLKVSHGGDGIVSAVKRFSIANGDELNDGVIEMIKVYVVQKR
KIQIGDKLAGRHGNKGVISKVVPIEDMPHLEDGTPVDILLNPLGVPSRMN
IGQIFETHLGYAAHKLAVRSLISSCFDQNKAKEFAIEINQPQARVERLIK
GLKNQINDRNIKSEKEALEKLDNSDISLVLKEIGMSFDDLIYKIATPIFQ
GVNFLDLQDVMQEAGLDPQKNQGKFKLIDGRSGMPFERPISLGIMYMMKL
NHMVDDKIHARAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAY
NLQELLTIKSDDVQGRNRAYAAIVKGAAFPEPGIPESFKLLTKELQGLAL
SVSFIYDDNTQQDSNNVSILQSDGEQDEFFNDFEFDTEGY*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
900
950
1000
1050
1100
1150
1200
1250
1300
1350
1391
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H11138C6942N1896O2122S38
Molecular weight (pH 7.5; Da) 156330.17 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
82155
Instability index 38.47
Is stable True
Aliphatic index 94.54
GRAVY (25C, pH 7.0) -0.373
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER, MG_392_393_21MER View in model
 
Function
Complex subunit DNA-directed RNA polymerase
[c]: MG_022_MONOMER + (2) MG_177_MONOMER + MG_340_MONOMER + MG_341_MONOMERRNA_POLYMERASE
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see RNA_POLYMERASE). Crystal structure available of Thermus thermophilus RNA polymerase [PUB_0430]. Gram positive bacteria such as mycoplasmas contain additional delta factor beyond gram negative RNA polymerase [PUB_0423]. RNA polymerase holoenzyme has structure β'βα2δσ [PUB_0355].
References
  1. Achberger EC, Whiteley HR. The role of the delta peptide of the Bacillus subtilis RNA polymerase in promoter selection. J Biol Chem 256, 7424-32 (1981). WholeCell: PUB_0423, PubMed: 6788769

  2. Bordier C, Rossetti GP. Subunit composition of Escherichia coli RNA polymerase during transcription in vitro. Eur J Biochem 65, 147-53 (1976). WholeCell: PUB_0355, PubMed: 776624

  3. Vassylyev DG, Sekine S, Laptenko O, Lee J, Vassylyeva MN, Borukhov S, Yokoyama S. Crystal structure of a bacterial RNA polymerase holoenzyme at 2.6 A resolution. Nature 417, 712-9 (2002). WholeCell: PUB_0430, PubMed: 12000971

 
Metadata
Created 2012-10-01 15:07:59
Last updated 2012-10-01 15:14:43