MG_336_MONOMER – cysteine desulfurase

Name
WID MG_336_MONOMER View in model
Name cysteine desulfurase View in model
 
Genetics
Gene MG_336 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MSAIKFNPSSFRKNFKWFENNKNWINFDNAATSIALDVVAEASKEYYQYF
CVNPHNKNPEINQKLIAIIEETRDLLAKFFNAKKNEIIFTSSATESLNLF
AFGLSSLVKSNDEIILKEDEHAANVFPWVNLAKENKAKLKIIKKTPNKSW
TDAFLKACTPSTKLLVITATSNLFGNSIDYEKISKHLKKISPNSFIVVDA
VQAVPHHKIDITSANIDFLTFSTHKFYGPTGLGIAFIKSELQSRLKPFKL
GGDIFKSLDNNFKIIFKEGPSKFEAGTLNIMAIYALNKQLKFMQKEFNFS
EMVFYSKQLKNLAYQLLSQNPNIVLANHDQDVPIFAFKHKYINSADLATF
LNIKKIIVRQGSICVGKFKNKESFLRVSLLHYNTKEELLYLEKLLKTSKN
SIINELIY*
50
100
150
200
250
300
350
400
409
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3375C2152N544O597S7
Molecular weight (pH 7.5; Da) 46644.43 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
40255
Instability index 32.43
Is stable True
Aliphatic index 94.72
GRAVY (25C, pH 7.0) -0.182
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit cysteine desulfurase
[c]: (2) MG_336_MONOMERMG_336_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0006]. Coenzymes Monomer interacts with PL5P with unknown stoichiometry as coenzyme [96].
References
  1. Keseler IM, Bonavides-Martínez C, Collado-Vides J, Gama-Castro S, Gunsalus RP, Johnson DA, Krummenacker M, Nolan LM, Paley S, Paulsen IT, Peralta-Gil M, Santos-Zavaleta A, Shearer AG, Karp PD. EcoCyc: a comprehensive view of Escherichia coli biology. Nucleic Acids Res 37, D464-70 (2009). WholeCell: PUB_0006, PubMed: 18974181

 
Metadata
Created 2012-10-01 15:07:58
Last updated 2012-10-01 15:14:43